Messages in this thread | | | Date | Sat, 12 Jul 2003 06:05:06 +0200 | From | Voluspa <> | Subject | Re: 2.5.75 does not boot - TCQ oops |
| |
On 2003-07-11 20:58:09 Ivan Gyurdiev wrote:
> Patch confirmed to work - the machine boots. [...] > Most massive fs corruption I've ever had. [...] > I blamed the reiserfs bk work at first (which I applied along with > [Axboe's] tcq patch), but I noted that the fs only gets corrupted > with a tcq-enabled kernel
I took home 2.5.75-bk1, applied the tcq patch and then used the computer for five hours in the TCQ+TASKFILE environment. Filesystem is ext2.
Untarred a kernel. Copied it to a couple of destinations. Compiled. Listened to music. Watched part of a movie. Did a nfs move of a file (which by the way was a pure horror... 600k in ca 3 minutes) from a machine with a 2.2.16 kernel. Then read about your woes.
Checked the md5sum of a large file that I keep for... corruption checks. Was ok. Did a read massage by "cd /usr ; find . -type f -exec md5sum {} \;". No hickups. Except...
Found 1 error in /var/log/kernel that I _never_ get with the 2.4.19: Jul 12 02:03:39 loke kernel: hda: status error: status=0x48 { DriveReady DataRequest } Jul 12 02:03:39 loke kernel: Jul 12 02:03:39 loke kernel: hda: drive not ready for command
So I shut down X in preparation for a reboot and full fs check, waiting for the distributed project foldingathome to checkpoint its work, and there was another never experienced error (time is UTC):
[01:10:00] [SPG] 100.0 % [01:10:00] [SPG] Writing current.xyz [01:10:01] [SPG] Sequence 15 completed: [01:10:01] SNEYSGTFSFKTKQSKDEMLDALQIKNSYISQMRQITPKMAIEYPKGTPT . . . [01:10:01] - Error: Checksums don't match (work/wudata_06.arc) [01:10:01] [SPG] Error: checksum error [01:10:02] CoreStatus = 0 (0) [01:10:02] Client-core communications error: ERROR 0x0 [01:10:02] Deleting current work unit & continuing...
The reboot didn't reveal any fs corruption. Still, I've returned to a safe kernel :-) Disk where TCQ was enabled (using depth 8) is a IBM-DTLA-307015. Unfortunately, or luckily, my IC35L080AVVA07-0 shares its life with a CD, so no TCQ there.
Mvh Mats Johannesson - To unsubscribe from this list: send the line "unsubscribe linux-kernel" in the body of a message to majordomo@vger.kernel.org More majordomo info at http://vger.kernel.org/majordomo-info.html Please read the FAQ at http://www.tux.org/lkml/
| |